PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g008360.2.1
Common NameLOC101268688
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 283aa    MW: 32407.3 Da    PI: 5.87
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g008360.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.94.9e-50101381129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF P+deel+++yL kk++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++
  Solyc06g008360.2.1  10 LPPGFRFYPSDEELISHYLYKKIANQEVIK-GTLVEIDLHTCEPWQLPEVAKLNSNEWYFFSFRDRKYATGFRTNRATISGYWKATGKDRT 99 
                         79************************9555.78***************88888999*********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                         v++  +g+l+g++ktLvfyk+rap+g kt W+mhe+rle
  Solyc06g008360.2.1 100 VFDPqTGALIGMRKTLVFYKNRAPHGIKTGWIMHEFRLE 138
                         **9867889***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-618156IPR003441NAC domain
PROSITE profilePS5100558.10810156IPR003441NAC domain
PfamPF023654.9E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGLRDIGSSL PPGFRFYPSD EELISHYLYK KIANQEVIKG TLVEIDLHTC EPWQLPEVAK  60
LNSNEWYFFS FRDRKYATGF RTNRATISGY WKATGKDRTV FDPQTGALIG MRKTLVFYKN  120
RAPHGIKTGW IMHEFRLENP HIPPKEDWVL CRVFFKGTKD ENINSTNNES TSITSFNMDN  180
HEGTMPKLLS YGGGEYRPST LPNFSTNSIY QNQNSSNNLQ LSQEINKVLA NEIIHSKCGK  240
EDEFGFLFDM NYFEESSLQD GGVHSCLDGD MKFEDENSLV FI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-47915614168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240497.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8515e-65NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLK4C3L60.0K4C3L6_SOLLC; Uncharacterized protein
STRINGSolyc06g008360.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.16e-90NAC domain containing protein 74
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]